Web stats for Shrivishwakarmasafetytraininginstitute - shrivishwakarmasafetytraininginstitute.com
4.67 Rating by ClearWebStats
shrivishwakarmasafetytraininginstitute.com is 1 year 3 months 1 week old. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, shrivishwakarmasafetytraininginstitute.com is SAFE to browse.
Traffic Report of Shrivishwakarmasafetytraininginstitute
| Daily Unique Visitors: | Not Applicable |
| Daily Pageviews: | Not Applicable |
Estimated Valuation
| Income Per Day: | $ 0.15 |
| Estimated Worth: | $ 8.95 |
Search Engine Indexes
| Google Indexed Pages: | Not Applicable |
| Yahoo Indexed Pages: | Not Applicable |
| Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
| Google Backlinks: | Not Applicable |
| Bing Backlinks: | Not Applicable |
| Alexa BackLinks: | Not Applicable |
Safety Information
| Google Safe Browsing: | No Risk Issues |
| Siteadvisor Rating: | Not Applicable |
| WOT Trustworthiness: | Not Applicable |
| WOT Privacy: | Not Applicable |
| WOT Child Safety: | Not Applicable |
Website Ranks & Scores
| Google Pagerank: | Not Applicable |
| Alexa Rank: | Not Applicable |
| Domain Authority: | Not Applicable |
Google Pagerank
PR 0 out of 10
PageSpeed Score
0
Siteadvisor Rating
Not Applicable
Where is shrivishwakarmasafetytraininginstitute.com server located?
Hosted IP Address:
162.241.148.33
Hosted Country:
US
Location Latitude:
40.2342Location Longitude:
-111.6442Social Engagement
| Facebook Shares: | Not Applicable |
| Facebook Likes: | Not Applicable |
| Facebook Comments: | Not Applicable |
| Twitter Count (Tweets): | Not Applicable |
| Linkedin Shares: | Not Applicable |
| Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
| H1 Headings: | Not Applicable | H2 Headings: | Not Applicable |
| H3 Headings: | Not Applicable | H4 Headings: | 1 |
| H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
| Total IFRAMEs: | Not Applicable | Total Images: | 1 |
| Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 162.241.148.33)
The Shine English Academy – DREAM | LEARN | SPEAK
Not Applicable 
$ 8.95
Urvashi International Packers and Movers|Movers and Packers Hyderabad
Packers and Movers in Hyderabad - Get best price quotes from Packers and Movers in Hyderabad, Movers and Packers in Hyderabad, Packers & Movers in Hyderabad also Get Quote by Hyderabad Packers and Movers from Hyderabad Packers and Movers
Not Applicable $ 8.95
247 Best Pill Pharma – Order Prescription Drugs in our Online shop
Not Applicable $ 8.95
HTTP Header Analysis
HTTP/2 200
link: <https://shrivishwakarmasafetytraininginstitute.com/wp-json/>; rel="https://api.w.org/", <https://shrivishwakarmasafetytraininginstitute.com/wp-json/wp/v2/pages/671>; rel="alternate"; type="application/json", <https://shrivishwakarmasafetytraininginstitute.com/>; rel=shortlink
vary: Accept-Encoding
content-encoding: gzip
content-length: 11287
content-type: text/html; charset=UTF-8
date: Mon, 23 Jan 2023 17:50:23 GMT
server: Apache
link: <https://shrivishwakarmasafetytraininginstitute.com/wp-json/>; rel="https://api.w.org/", <https://shrivishwakarmasafetytraininginstitute.com/wp-json/wp/v2/pages/671>; rel="alternate"; type="application/json", <https://shrivishwakarmasafetytraininginstitute.com/>; rel=shortlink
vary: Accept-Encoding
content-encoding: gzip
content-length: 11287
content-type: text/html; charset=UTF-8
date: Mon, 23 Jan 2023 17:50:23 GMT
server: Apache
Domain Information for shrivishwakarmasafetytraininginstitute.com
| Domain Registrar: |
OwnRegistrar, Inc.
|
|---|---|
| Registration Date: | 2023-01-18 1 year 3 months 1 week ago |
| Last Modified: | 2023-01-18 1 year 3 months 1 week ago |
Domain Nameserver Information
| Host | IP Address | Country | |
|---|---|---|---|
| ns1.bh-ht-17.webhostbox.net |
|
162.241.148.33 |
United States
|
| ns2.bh-ht-17.webhostbox.net |
|
162.241.148.33 |
United States
|
DNS Record Analysis
| Host | Type | TTL | Extra |
|---|---|---|---|
| shrivishwakarmasafetytraininginstitute.com | A | 14400 |
IP:162.241.148.33 |
| shrivishwakarmasafetytraininginstitute.com | NS | 21600 |
Target:ns1.bh-ht-17.webhostbox.net |
| shrivishwakarmasafetytraininginstitute.com | NS | 21600 |
Target:ns2.bh-ht-17.webhostbox.net |
| shrivishwakarmasafetytraininginstitute.com | SOA | 21600 |
MNAME:ns1.bh-ht-17.webhostbox.net RNAME:root.bh-ht-17.webhostbox.net Serial:2023011814 Refresh:86400 Retry:7200 Expire:3600000 |
| shrivishwakarmasafetytraininginstitute.com | MX | 14400 |
Target:mail.shrivishwakarmasafetytraininginstitute.com |
| shrivishwakarmasafetytraininginstitute.com | TXT | 14400 |
TXT:v=spf1 a mx include:websitewelcome.com ~all |
Similarly Ranked Websites to Shrivishwakarmasafetytraininginstitute
Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.
1 $ 8,833,062,960.00
Google Calendar - Sign in to Access & Edit Your Schedule
Access Google Calendar with a Google account (for personal use) or Google Workspace account (for business use).
1 $ 8,833,062,960.00
Gmail
Gmail is email that’s intuitive, efficient, and useful. 15 GB of storage, less spam, and mobile access.
1 $ 8,833,062,960.00
Android Apps on Google Play
Enjoy millions of the latest Android apps, games, music, movies, TV, books, magazines & more. Anytime, anywhere, across your devices.
1 $ 8,833,062,960.00
Google Chrome - Download the Fast, Secure Browser from Google
Get more done with the new Google Chrome. A more simple, secure, and faster web browser than ever, with Google’s smarts built-in. Download now.
1 $ 8,833,062,960.00
Full WHOIS Lookup for shrivishwakarmasafetytraininginstitute.com
Domain Name: SHRIVISHWAKARMASAFETYTRAININGINSTITUTE.COM
Registry Domain ID: 2752155443_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.ownregistrar.com
Registrar URL: http://www.ownregistrar.com
Updated Date: 2023-01-18T05:08:31Z
Creation Date: 2023-01-18T05:08:16Z
Registry Expiry Date: 2024-01-18T05:08:16Z
Registrar: OwnRegistrar, Inc.
Registrar IANA ID: 1250
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.BH-HT-17.WEBHOSTBOX.NET
Name Server: NS2.BH-HT-17.WEBHOSTBOX.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2023-01-23T17:50:20Z
Registry Domain ID: 2752155443_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.ownregistrar.com
Registrar URL: http://www.ownregistrar.com
Updated Date: 2023-01-18T05:08:31Z
Creation Date: 2023-01-18T05:08:16Z
Registry Expiry Date: 2024-01-18T05:08:16Z
Registrar: OwnRegistrar, Inc.
Registrar IANA ID: 1250
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.BH-HT-17.WEBHOSTBOX.NET
Name Server: NS2.BH-HT-17.WEBHOSTBOX.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2023-01-23T17:50:20Z