Web stats for Shrivishwakarmasafetytraininginstitute - shrivishwakarmasafetytraininginstitute.com
Traffic Report of Shrivishwakarmasafetytraininginstitute
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Yahoo Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Alexa BackLinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Privacy: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Google Pagerank: | Not Applicable |
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
PageSpeed Score
Siteadvisor Rating
Where is shrivishwakarmasafetytraininginstitute.com server located?
Social Engagement
Facebook Shares: | Not Applicable |
Facebook Likes: | Not Applicable |
Facebook Comments: | Not Applicable |
Twitter Count (Tweets): | Not Applicable |
Linkedin Shares: | Not Applicable |
Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | 1 |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 1 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 162.241.148.33)
The Shine English Academy – DREAM | LEARN | SPEAK
Urvashi International Packers and Movers|Movers and Packers Hyderabad
Packers and Movers in Hyderabad - Get best price quotes from Packers and Movers in Hyderabad, Movers and Packers in Hyderabad, Packers & Movers in Hyderabad also Get Quote by Hyderabad Packers and Movers from Hyderabad Packers and Movers
247 Best Pill Pharma – Order Prescription Drugs in our Online shop
HTTP Header Analysis
link: <https://shrivishwakarmasafetytraininginstitute.com/wp-json/>; rel="https://api.w.org/", <https://shrivishwakarmasafetytraininginstitute.com/wp-json/wp/v2/pages/671>; rel="alternate"; type="application/json", <https://shrivishwakarmasafetytraininginstitute.com/>; rel=shortlink
vary: Accept-Encoding
content-encoding: gzip
content-length: 11287
content-type: text/html; charset=UTF-8
date: Mon, 23 Jan 2023 17:50:23 GMT
server: Apache
Domain Information for shrivishwakarmasafetytraininginstitute.com
Domain Nameserver Information
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
shrivishwakarmasafetytraininginstitute.com | A | 14400 |
IP:162.241.148.33 |
shrivishwakarmasafetytraininginstitute.com | NS | 21600 |
Target:ns1.bh-ht-17.webhostbox.net |
shrivishwakarmasafetytraininginstitute.com | NS | 21600 |
Target:ns2.bh-ht-17.webhostbox.net |
shrivishwakarmasafetytraininginstitute.com | SOA | 21600 |
MNAME:ns1.bh-ht-17.webhostbox.net RNAME:root.bh-ht-17.webhostbox.net Serial:2023011814 Refresh:86400 Retry:7200 Expire:3600000 |
shrivishwakarmasafetytraininginstitute.com | MX | 14400 |
Target:mail.shrivishwakarmasafetytraininginstitute.com |
shrivishwakarmasafetytraininginstitute.com | TXT | 14400 |
TXT:v=spf1 a mx include:websitewelcome.com ~all |
Similarly Ranked Websites to Shrivishwakarmasafetytraininginstitute
Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.
Google Calendar - Sign in to Access & Edit Your Schedule
Access Google Calendar with a Google account (for personal use) or Google Workspace account (for business use).
Gmail
Gmail is email that’s intuitive, efficient, and useful. 15 GB of storage, less spam, and mobile access.
Android Apps on Google Play
Enjoy millions of the latest Android apps, games, music, movies, TV, books, magazines & more. Anytime, anywhere, across your devices.
Google Chrome - Download the Fast, Secure Browser from Google
Get more done with the new Google Chrome. A more simple, secure, and faster web browser than ever, with Google’s smarts built-in. Download now.
Full WHOIS Lookup for shrivishwakarmasafetytraininginstitute.com
Registry Domain ID: 2752155443_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.ownregistrar.com
Registrar URL: http://www.ownregistrar.com
Updated Date: 2023-01-18T05:08:31Z
Creation Date: 2023-01-18T05:08:16Z
Registry Expiry Date: 2024-01-18T05:08:16Z
Registrar: OwnRegistrar, Inc.
Registrar IANA ID: 1250
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.BH-HT-17.WEBHOSTBOX.NET
Name Server: NS2.BH-HT-17.WEBHOSTBOX.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2023-01-23T17:50:20Z